Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA024697_circ_g.5 |
ID in PlantcircBase | osi_circ_007074 |
Alias | 7:4554752|4555524 |
Organism | Oryza sativa ssp. indica |
Position | chr7: 4554752-4555524 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA024697 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | BGIOSGA024697_circ_g.2 BGIOSGA024697_circ_g.3 BGIOSGA024697_circ_g.4 BGIOSGA024697_circ_g.6 BGIOSGA024697_circ_g.7 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | BGIOSGA024697-TA:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_033060* |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4555408-4555519(-) |
Potential amino acid sequence |
MQVPKVSMQHNVMIEAVENHMPEVIVIDEIGTELEAMAASTIAQRGVQLVGTAHGVTIESIIKN PCLQVLVGGIESVTLGDEEAKKRKVQKTILERKGPPTFSCAVEMISKTECRVHHKLEATVDAIL AGK*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |