Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d039816_circ_g.1 |
ID in PlantcircBase | zma_circ_007509 |
Alias | Zm03circ00016 |
Organism | Zea mays |
Position | chr3: 15643667-15644298 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d039816 |
Parent gene annotation |
Aspartate--tRNA ligase chloroplastic/mitochondrial |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d039816_T001:2 Zm00001d039816_T002:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.152829813 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15643726-15643678(+) 15644298-15643678(+) |
Potential amino acid sequence |
MEVAFTSMEDMLKLNEDLMRHVFQAVGDIKLPNPFPRLTYAEAMDRYGTDRPDLRFDWELKDVL PR*(+) MCFRDEDLRADRQPEFTQLDMEVAFTSMEDMLKLNEDLMRHVFQAVGDIKLPNPFPRLTYAEAM DRYGTDRPDLRFDWELKDVLPR*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020 |