Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d015798_circ_g.1 |
ID in PlantcircBase | zma_circ_008645 |
Alias | zma_circ_0001861 |
Organism | Zea mays |
Position | chr5: 121145544-121145757 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d015798 |
Parent gene annotation |
Subtilisin-like protease SBT5.3 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d015798_T001:1 Zm00001d015798_T002:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.353995898 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
121145662-121145565(+) 121145718-121145565(+) 121145751-121145645(-) |
Potential amino acid sequence |
MSCPHVSGVVGLLRTLHPEWSPAAIKSAIMTTARHHGARSERDRRVDPCQLADGPRLRPAARGL QLRVRHVHVLPARLRRRWPPPHSPPGMEPRGHQVGHHDHSPTSRRPE*(+) MEPRGHQVGHHDHSPTSRRPE*(+) MMADLMAAGLHSGWRVRRRPTTPETCGQDMDVPDSELKATRRRSKARSVGELARVHAAITLTPG AVMSGCGHDGRLDGRGAPFRVESAEEANDAGDVRAGHGRAGL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |