Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0613200_circ_g.7 |
| ID in PlantcircBase | osa_circ_012292 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 25974784-25974906 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0613200 |
| Parent gene annotation |
Hypothetical conserved gene. (Os12t0613200-01);Similar to Histon e-lysine N-methyltransferase, H3 lysine-4 specific SET1 (EC 2.1. 1.43) (Set1/Ash2 histone methyltransferase complex subunit SET1) (SET-domain-containing protein 1). (Os12t0613200-02);Hypothetic al conserved gene. (Os12t0613200-03) |
| Parent gene strand | - |
| Alternative splicing | Os12g0613200_circ_g.6 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0613200-01:1 Os12t0613200-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.306451491 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25974886-25974903(+) 25974881-25974786(-) |
| Potential amino acid sequence |
MILHLKDSLKGHVDSYCDANKKVQQENVAHACGLLRPQTSNMILHLKDSLKGHVDSYCDANKKV QQENVAHACGLLRPQTSNMILHLKDSLKGHVDSYCDANKKVQQENVAHACGLLRPQTSNMILHL KD(+) MFEDAEGRRHGPHSLAELSYWHHSSYLHDLSMNLSSEESCWMFEDAEGRRHGPHSLAELSYWHH SSYLHDLSMNLSSEESCWMFEDAEGRRHGPHSLAELSYWHHSSYLHDLSMNLSSEESCWMFEDA EGRRHGPHSLAELSYWHHSSYLHDLSM(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |