Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT5G54730_circ_g.1 |
ID in PlantcircBase | ath_circ_044123 |
Alias | At_ciR1312, AT5G54730_C1 |
Organism | Arabidpsis thaliana |
Position | chr5: 22235297-22235527 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | KNIFE, PcircRNA_finder, find_circ, CIRI-full, CIRI2 |
Parent gene | AT5G54730 |
Parent gene annotation |
Autophagy-related protein 18f |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 3/6 |
Tissues | leaf/whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT5G54730.2:1 AT5G54730.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.410492197 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22235381-22235299(-) |
Potential amino acid sequence |
MPTISTSRAVKTTTFAHLFRLQRGFTNAVIVKDITNKSVITQFKAHKSPISALCFDQSGLLLVT ASIQGHNINVFRIMPTISTSRAVKTTTFAHLFRLQRGFTNAVIVKDITNKSVITQFKAHKSPIS ALCFDQSGLLLVTASIQGHNINVFRIMPTISTSRAVKTTTFAHLFRLQRGFTNAVIVKDITNKS VITQFKAHKSPISALCFDQSGLLLVTASIQGHNINVFRIMPTISTSRAVKTTTFAHLFRLQRGF TNA(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017;Zhang et al., 2019 |