Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G54730_circ_g.1 |
| ID in PlantcircBase | ath_circ_044123 |
| Alias | At_ciR1312, AT5G54730_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr5: 22235297-22235527 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | KNIFE, PcircRNA_finder, find_circ, CIRI-full, CIRI2 |
| Parent gene | AT5G54730 |
| Parent gene annotation |
Autophagy-related protein 18f |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 3/6 |
| Tissues | leaf/whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT5G54730.2:1 AT5G54730.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.410492197 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22235381-22235299(-) |
| Potential amino acid sequence |
MPTISTSRAVKTTTFAHLFRLQRGFTNAVIVKDITNKSVITQFKAHKSPISALCFDQSGLLLVT ASIQGHNINVFRIMPTISTSRAVKTTTFAHLFRLQRGFTNAVIVKDITNKSVITQFKAHKSPIS ALCFDQSGLLLVTASIQGHNINVFRIMPTISTSRAVKTTTFAHLFRLQRGFTNAVIVKDITNKS VITQFKAHKSPISALCFDQSGLLLVTASIQGHNINVFRIMPTISTSRAVKTTTFAHLFRLQRGF TNA(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017;Zhang et al., 2019 |