Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0579000_circ_g.2 |
ID in PlantcircBase | osa_circ_012110 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 23962525-23962707 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | Os12g0579000 |
Parent gene annotation |
Leo1-like protein family protein. (Os12t0579000-01) |
Parent gene strand | + |
Alternative splicing | Os12g0579000_circ_g.1 Os12g0579000_circ_g.3 Os12g0579000_circ_g.4 |
Support reads | 8 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os12t0579000-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.152547177 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23962535-23962704(+) |
Potential amino acid sequence |
MEDEGHYEKDLQPDDVVADEDMRYESDENRELKPKEKPVGPPLNLVVPLKQPPAQPERRSPMED EGHYEKDLQPDDVVADEDMRYESDENRELKPKEKPVGPPLNLVVPLKQPPAQPERRSPMEDEGH YEKDLQPDDVVADEDMRYESDENRELKPKEKPVGPPLNLVVPLKQPPAQPERRSPMEDEGHYEK DLQPDDVVADEDMRYESDENRELKPKEKPVGPPLNLVVPLKQPPAQPER(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |