Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Solyc12g006450.1_circ_g.2 |
ID in PlantcircBase | sly_circ_003497 |
Alias | 12:922972|923430 |
Organism | Solanum lycopersicum |
Position | chr12: 922972-923430 JBrowse» |
Reference genome | SL2.50.38 |
Type | e-circRNA |
Identification method | CIRI |
Parent gene | Solyc12g006450.1 |
Parent gene annotation |
protein_coding |
Parent gene strand | - |
Alternative splicing | Solyc12g006450.1_circ_g.1 Solyc12g006450.1_circ_g.3 |
Support reads | 2 |
Tissues | fruit |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Solyc12g006450.1.1:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.221911238 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
923146-923029(+) 923354-923417(-) |
Potential amino acid sequence |
MTSETSGLTRTAPIGIYPEERAFATETRSGLMLYFSHPNIVPSLPNPHITSSAMKRMSYFFSIA WTCRSSVFPRQLHTRQGAPSK*(+) MFGCEKYNIKPDLVSVAKALSSGYMPIGAVLVSPEVSDVIYSQSNKLGTFSHGFTYSGHPVSCA VALETLKIYKSKLY*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Yin et al., 2018 |