Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0307200_circ_g.3 |
| ID in PlantcircBase | osa_circ_023373 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 13837849-13839317 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0307200 |
| Parent gene annotation |
Similar to Cysteine string protein (CCCS1). (Os04t0307200-01);Si milar to OSIGBa0125J07.5 protein. (Os04t0307200-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0307200-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.258504935 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13837857-13837869(+) 13837871-13839242(-) |
| Potential amino acid sequence |
MDVFIKAAEYMEMPVRRSDDEPLQKLFVAVRSELNLDLKNIRTEQAKFWKQHPSLVKMELLIQA HLTGESFALTPALLKDYRHMLELAPRLLDELVKIALLPRSPHGFGWLRPAIGVIELSQNIIQQS HGCLH*(+) MKTSMTLLDDILGKLNYTDCRPEPSKTMGTPW*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |