Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G12840_circ_g.13 |
ID in PlantcircBase | ath_circ_002315 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 4377551-4377634 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT1G12840 |
Parent gene annotation |
V-type proton ATPase subunit C |
Parent gene strand | + |
Alternative splicing | AT1G12840_circ_g.4 AT1G12840_circ_g.5 AT1G12840_circ_g.6 AT1G12840_circ_g.7 AT1G12840_circ_g.8 AT1G12840_circ_g.9 AT1G12840_circ_g.10 AT1G12840_circ_g.11 AT1G12840_circ_g.12 |
Support reads | 1 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G12840.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.385191268 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4377566-4377631(+) 4377604-4377553(-) |
Potential amino acid sequence |
MHFCAVRTFAESIMRYGLPPAFLVFSSWMHFCAVRTFAESIMRYGLPPAFLVFSSWMHFCAVRT FAESIMRYGLPPAFLVFSSWMHFCAVRTFAESIMRYGLPPAFL(+) MLSANVRTAQKCIQELKTKNAGGKPYLIMLSANVRTAQKCIQELKTKNAGGKPYLIMLSANVRT AQKCIQELKTKNAGGKPYLIMLSANVRTAQKCIQELK(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |