Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G11820_circ_g.4 |
| ID in PlantcircBase | ath_circ_030424 |
| Alias | AT4G11820_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr4: 7109878-7110409 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, CIRI2 |
| Parent gene | AT4G11820 |
| Parent gene annotation |
Hydroxymethylglutaryl-CoA synthase |
| Parent gene strand | - |
| Alternative splicing | AT4G11820_circ_g.1 AT4G11820_circ_g.2 AT4G11820_circ_g.3 AT4G11820_circ_g.5 AT4G11820_circ_g.6 AT4G11820_circ_g.7 |
| Support reads | 3 |
| Tissues | root, whole_plant, leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT4G11820.3:4 AT4G11820.2:4 AT4G11820.1:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.216020929 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7110374-7109880(-) |
| Potential amino acid sequence |
MALDSCYKHLCNKFEKIEGKEFSINDADYIVFHSPYNKLVQKSFARLLYNDFLRNASSIDEAAK EKFTPYSSLTLDESYQSRDLEKVVDGKLSQTCYLMALDSCYKHLCNKFEKIEGKEFSINDADYI VFHSPYNKLVQKSFARLLYNDFLRNASSIDEAAKEKFTPYSSLTLDESYQSRDLEKVVDGKLSQ TCYLMALDSCYKHLCNKFEKIEGKEFSINDADYIVFHSPYNKLVQKSFARLLYNDFLRNASSID EAAKEKFTPYSSLTLDESYQSRDLEKVVDGKLSQTCYLMALDSCYKHLCNKFEKIEGKEFSIND ADYIVFHSPYNKLVQKSFARLLYNDFLRNASSIDEAAKEKFTPYSSLTLDESYQSRDLEK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Zhang et al., 2019 |