Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0128400_circ_g.4 |
ID in PlantcircBase | osa_circ_000205 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 1572919-1575713 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0128400 |
Parent gene annotation |
Protein of unknown function DUF2359, TMEM214 domain containing p rotein. (Os01t0128400-01);Similar to predicted protein. (Os01t01 28400-02) |
Parent gene strand | - |
Alternative splicing | Os01g0128400_circ_g.1 Os01g0128400_circ_g.2 Os01g0128400_circ_g.3 Os01g0128400_circ_g.5 Os01g0128400_circ_g.6 Os01g0128400_circ_g.7 Os01g0128400_circ_g.8 Os01g0128400_circ_g.9 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0128400-01:6 Os01t0128400-02:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.1060991 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1575682-1575579(-) |
Potential amino acid sequence |
MRFADYFGRSFASVSAAQFPWAKMFKESLVSKMVDIPLCHIPEPVRNTASDWINQRSPDALGDF VMWCIDSIMSELSGQAVGAKGSKKAAQQTPRAQVAIFVVLALTVRRKPEVLTNVLPKIMGNNKY LGQEKLPIIVWVIAQASQGDLVTGMFCWAHFLFPTLCAKPSGNPQTRDLVLQLLERILSAPKAR GILLNGAVRKGERLIPPVTFDLFMRAAFPVSSARVKATERFEAAYPTIKELALAGPPGSKTVKQ AAQQLLPLCVKAMQERILREPAGYSAHAVRRLLWQVICKRERRPVPLGEDVQGITSVQDG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |