Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G44710_circ_g.5 |
| ID in PlantcircBase | ath_circ_018385 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr2: 18434303-18434542 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, CIRI-full |
| Parent gene | AT2G44710 |
| Parent gene annotation |
At2g44720/F16B22.21 |
| Parent gene strand | + |
| Alternative splicing | AT2G44710_circ_g.4 AT2G44710_circ_g.6 AT2G44710_circ_g.7 AT2G44710_circ_g.8 AT2G44710_circ_g.9 AT2G44710_circ_g.10 AT2G44710_circ_g.11 AT2G44710_circ_g.12 AT2G44710_circ_g.13 AT2G44710_circ_g.14 AT2G44710_circ_g.15 |
| Support reads | 1 |
| Tissues | aerial |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT2G44710.2:1 AT2G44710.4:1 AT2G44710.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.469057002 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18434339-18434539(+) |
| Potential amino acid sequence |
MDDITLVEDSNNVNMNRGYAFLEFSSRSDAMDAHKRLVKKDVMFGVEKPAKVSFTDSFLDLEDE IMAQLREKLKHYGVENMDDITLVEDSNNVNMNRGYAFLEFSSRSDAMDAHKRLVKKDVMFGVEK PAKVSFTDSFLDLEDEIMAQLREKLKHYGVENMDDITLVEDSNNVNMNRGYAFLEFSSRSDAMD AHKRLVKKDVMFGVEKPAKVSFTDSFLDLEDEIMAQLREKLKHYGVENMDDITLVEDSNNVNMN RGYAFLEFSSRSDAMDAHKRLVKKDVMFGVEKPAKVSFTDSFLDLEDEIMAQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |