Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.011G277200_circ_g.3 |
| ID in PlantcircBase | gra_circ_001275 |
| Alias | Chr11:60976234|60976516 |
| Organism | Gossypium raimondii |
| Position | chrChr11: 60976234-60976516 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.011G277200 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | orai.011G276400_circ_ag.1 orai.011G277200_circ_g.1 orai.011G277200_circ_g.2 |
| Support reads | 9 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.011G277200.3:2 Gorai.011G277200.1:2 Gorai.011G277200.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.518256773 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
60976514-60976335(+) 60976361-60976255(+) |
| Potential amino acid sequence |
MLISKSSSIALVDYHLIQSQLFTAIFPQCFNGPPL*(+) MNSKCSFTSGQKWMTQLCIVFKWHSSSPCLYPNPVV*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |