Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0944000_circ_g.3 |
| ID in PlantcircBase | osa_circ_005778 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 41493285-41493586 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0944000 |
| Parent gene annotation |
Conserved hypothetical protein. (Os01t0944000-01);Hypothetical c onserved gene. (Os01t0944000-02);Conserved hypothetical protein. (Os01t0944000-03) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0944000-01:2 Os01t0944000-02:2 Os01t0944000-03:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.329499411 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
41493508-41493309(+) 41493533-41493331(+) 41493331-41493340(-) |
| Potential amino acid sequence |
MILKQSINNEENPHAAIPLSATYTSGNLLEYWAST*(+) MRKTRMLLSLCQQHIHLGTYLNTGPQHKAISFPW*(+) METIWPYVEAQYSSKFPDVYVADKGIAACGFSSLFMDCFKIMENVLEKQDDHSISSGVA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |