Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d040462_circ_g.1 |
ID in PlantcircBase | zma_circ_007559 |
Alias | zma_circ_0001451 |
Organism | Zea mays |
Position | chr3: 44594200-44595197 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d040462 |
Parent gene annotation |
COP9 signalosome complex subunit 2 |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d040462_T003:2 Zm00001d040462_T001:2 Zm00001d040462_T004:2 Zm00001d040462_T002:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.158784852 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
44595100-44595193(-) 44594210-44595193(-) |
Potential amino acid sequence |
MYTETKNNKKLKELYQRALSIKSAIPHPRIMGIIRECGGKMHMAERQWAEAATDFFEAFKNYDE AGNPRRIQCLKY*(-) MPKILKELHKSCQREDGSDDQKKGTQLLEVYAIEIQMYTETKNNKKLKELYQRALSIKSAIPHP RIMGIIRECGGKMHMAERQWAEAATDFFEAFKNYDEAGNPRRIQCLKY*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |