Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G48600_circ_g.6 |
ID in PlantcircBase | ath_circ_006348 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 17968439-17968749 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | KNIFE, PcircRNA_finder |
Parent gene | AT1G48600 |
Parent gene annotation |
PMEAMT |
Parent gene strand | + |
Alternative splicing | AT1G48600_circ_g.5 |
Support reads | 91 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G48600.2:2 AT1G48600.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.224686549 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
17968696-17968746(+) |
Potential amino acid sequence |
MLKDAGFDDVIAEDRTDQDKPALFRTFFKWLKPGGKVLITDYCRSAETPSPEFAEYIKQRGYDL HDVQAYGQMLKDAGFDDVIAEDRTDQDKPALFRTFFKWLKPGGKVLITDYCRSAETPSPEFAEY IKQRGYDLHDVQAYGQMLKDAGFDDVIAEDRTDQDKPALFRTFFKWLKPGGKVLITDYCRSAET PSPEFAEYIKQRGYDLHDVQAYGQMLKDAGFDDVIAEDRTDQ(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |