Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0745100_circ_g.12 |
| ID in PlantcircBase | osa_circ_016550 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 31268565-31268925 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0745100 |
| Parent gene annotation |
Aquaporin NIP III subfamily protein, Aquaporin, Silicon influx t ransporter, Arsenic species (As) uptake, Arsenite efflux, Seleni te (Se) uptake, Water transport (Os02t0745100-01) |
| Parent gene strand | + |
| Alternative splicing | Os02g0745100_circ_g.1 Os02g0745100_circ_g.2 Os02g0745100_circ_g.3 Os02g0745100_circ_g.4 Os02g0745100_circ_g.5 Os02g0745100_circ_g.6 Os02g0745100_circ_g.7 Os02g0745100_circ_g.8 Os02g0745100_circ_g.9 Os02g0745100_circ_g.10 Os02g0745100_circ_g.11 Os02g0745100_circ_g.13 Os02g0745100_circ_g.14 Os02g0745100_circ_g.15 Os02g0745100_circ_g.16 Os02g0745100_circ_g.17 Os02g0745100_circ_g.18 Os02g0745100_circ_g.19 Os02g0745100_circ_g.20 Os02g0745100_circ_g.21 Os02g0745100_circ_g.22 Os02g0745100_circ_g.23 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0745100-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | zma_circ_002143 |
| PMCS | 0.253142059 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
31268719-31268628(+) |
| Potential amino acid sequence |
MMFVTLAVATDTRAVGELAGLAVGSAVCITSIFAGFRSTGRRSSPERYARRSCSRR*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |