Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d023238_circ_g.2 |
| ID in PlantcircBase | zma_circ_010131 |
| Alias | Zm10circ00001, GRMZM2G176546_C1 |
| Organism | Zea mays |
| Position | chr10: 1112079-1112358 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d023238 |
| Parent gene annotation |
Long chain acyl-CoA synthetase 6 peroxisomal |
| Parent gene strand | + |
| Alternative splicing | Zm00001d023238_circ_g.1 |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d023238_T004:2 Zm00001d023238_T003:2 Zm00001d023238_T001:2 Zm00001d023238_T008:1 Zm00001d023238_T006:2 Zm00001d023238_T010:2 Zm00001d023238_T005:1 Zm00001d023238_T002:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.278027124 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1112095-1112080(+) 1112333-1112080(+) 1112097-1112147(-) |
| Potential amino acid sequence |
MDDLAALRPTIFASVPRLYNRIYTAITNAVKESGGLKEKLFHTAYNAKRQAILKG*(+) MPRDKQSLKDNLKLMDDLAALRPTIFASVPRLYNRIYTAITNAVKESGGLKEKLFHTAYNAKRQ AILKG*(+) MSFKLSFKDCLSLGIVCSMKQFFFQPTRLLHSICNRSINSVI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Han et al., 2020;Zhang et al., 2019 |