Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0832200_circ_g.1 |
ID in PlantcircBase | osa_circ_017380 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 35786104-35787147 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0832200 |
Parent gene annotation |
Similar to chloroplast channel forming outer membrane protein. ( Os02t0832200-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0832200-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.118319349 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
35787111-35786137(+) 35787088-35787106(-) 35786111-35786126(-) |
Potential amino acid sequence |
MVHANSTAAVRAVSIHCLLITDQT*(+) MSGSNLDINSCTRCLISNSGKTIGLLMLIWMENGMLGLICDQKAMNGDRPDCCRRVSMDHT*(- ) METARTAAVELAWTILDLKRGQDVRLKLGYQLLHKMPYFQLRENNWTFNAYMDGKWDVRFDL*( -) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |