Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G59100_circ_g.6 |
| ID in PlantcircBase | ath_circ_028235 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr3: 21847520-21847906 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT3G59100 |
| Parent gene annotation |
Putative callose synthase 6 |
| Parent gene strand | + |
| Alternative splicing | AT3G59100_circ_g.5 |
| Support reads | 2 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT3G59100.2:3 AT3G59100.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.211830557 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21847547-21847903(+) |
| Potential amino acid sequence |
MIMNLHIGHYQWHEFFPHATNNIGVVIAIWAPIVLVYLMDTQIWYAIFSTLFGGIHGAFSHLGE ILPLITPTKMIMNLHIGHYQWHEFFPHATNNIGVVIAIWAPIVLVYLMDTQIWYAIFSTLFGGI HGAFSHLGEILPLITPTKMIMNLHIGHYQWHEFFPHATNNIGVVIAIWAPIVLVYLMDTQIWYA IFSTLFGGIHGAFSHLGEILPLITPTKMIMNLHIGHYQWHEFFPHATNNIGVVIAIWAPIVLVY LMDTQIWYAIFSTLFGGIHGAFSHLGE(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |