Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0373500_circ_g.1 |
| ID in PlantcircBase | osa_circ_027676 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 18004428-18005002 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0373500 |
| Parent gene annotation |
Hypothetical conserved gene. (Os05t0373500-00) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0373500-00:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_015386 |
| PMCS | 0.296375899 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18004925-18004516(+) 18004984-18004996(-) |
| Potential amino acid sequence |
MSNSSLEVLPLNSETVFCSIKLATMSAHRDRAVVLPSFGLSTHSFYLALYRLGSSE*(+) MLQKTVSELSGSTSKLEFDIYGEIGIPNSTVAVNFLQPIGAPNWTNVIFSIVPYPKYSSISSMY LSILRASFMSLVVEQSTLHLTESLFGDTSLFEVLKFPGGITIIPPQAAFLLQKPYASFNFTLNF PIYKVQGRMNELKDQMKAGLQLDPYELT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |