Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0546100_circ_g.2 |
ID in PlantcircBase | osa_circ_034191 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 21630713-21632064 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ui-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os07g0546150 |
Parent gene annotation |
Hypothetical protein. (Os07t0546150-00) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os07t0546100-02:3 Os07t0546100-01:3 Os07t0546100-02:3 Os07t0546100-01:3 Os07t0546150-00:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_017175 |
PMCS | 0.116849673 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21630765-21630762(-) |
Potential amino acid sequence |
MNNVNLHSIRDHWNLMHLPTGDVLSRSLAKASIPRSLRTCSLGRAPPKRDCLSFGALSSDCPTA LERGFRFNRGRSTARPSASAPATPALGATTFWCTS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |