Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA026121_circ_g.2 |
ID in PlantcircBase | osi_circ_007330 |
Alias | 7:23278206|23279118 |
Organism | Oryza sativa ssp. indica |
Position | chr7: 23278206-23279118 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA026121 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | BGIOSGA026119_circ_ig.1 BGIOSGA026120_circ_g.1 BGIOSGA026121_circ_g.1 BGIOSGA026121_circ_g.3 BGIOSGA026122_circ_g.1 BGIOSGA026122_circ_g.2 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | BGIOSGA026121-TA:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23278228-23278219(+) |
Potential amino acid sequence |
MMAQKVMYERFGENFVVNFVTKLREAHCPPDLAEQYYQKLQGSCIIYVHKALPFLRSEDCPVW* (+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |