Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0440100_circ_g.3 |
| ID in PlantcircBase | osa_circ_006894 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 15815543-15816771 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os10g0440100 |
| Parent gene annotation |
DP TF. (Os10t0440100-00) |
| Parent gene strand | - |
| Alternative splicing | Os10g0440100_circ_g.1 Os10g0440100_circ_g.2 Os10g0440100_circ_g.4 |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0440100-00:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.162725644 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15816697-15816729(-) |
| Potential amino acid sequence |
MKVCEKVESKGRTTYNEVADELVAEFADPNNNFASPDPDNPNTPQFDEKNIRRRVYDALNVLMA MDIISKDKKEIQWKGLPRTSMSDVEELKTEIIGLKGRIDKKNAYLQELEDQQEEKKGAWNTCNG P*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |