Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_19G260700_circ_g.2 |
| ID in PlantcircBase | gma_circ_005097 |
| Alias | Gm19circRNA2445, gma-circRNA2679 |
| Organism | Glycine max |
| Position | chr19: 50387519-50387829 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | Tophat, find_circ |
| Parent gene | GLYMA_19G260700 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | GLYMA_19G260700_circ_g.1 |
| Support reads | NA |
| Tissues | stem, flower bud |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRG97256:1 KRG97257:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.460216345 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
50387790-50387540(+) 50387713-50387821(-) 50387538-50387760(-) |
| Potential amino acid sequence |
MEYPLPELNLSAPTRIGRSMF*(+) MINHTTIVMKKVLECYKGFENIKMLVDVGGGLGININLITSKYPHIQGINFDLPHVLEHAPSYP GRS*(-) MLLPILVGAERFNSGRGYSIQQGLWHSCF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | cytoplasmic male sterility |
| Other Information | |
|---|---|
| References | Zhao et al., 2017a; Chen et al., 2018 |