Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT5G37500_circ_g.3 |
ID in PlantcircBase | ath_circ_041352 |
Alias | AT5G37500_C1, CircGORK |
Organism | Arabidpsis thaliana |
Position | chr5: 14892940-14893314 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | AT5G37500 |
Parent gene annotation |
gated outwardly-rectifying K+ channel |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT5G37500.3:2 AT5G37500.2:2 AT5G37500.1:2 AT5G37500.4:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.275256502 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14893297-14893221(-) |
Potential amino acid sequence |
MFILVWAIYSSLFTPMEFGFFRGLPERLFVLDIVGQIAFLVDIVLQFFVAYRDTQTYRTVYKPT RIAFRYLKSHFLMDFIGCFPWDLIYKVVQGMGNVYIGVGNILLIVHSHGVWFLPRSA* |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress (validated) |
Other Information | |
---|---|
References | Zhang et al., 2019 |