Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G37500_circ_g.3 |
| ID in PlantcircBase | ath_circ_041352 |
| Alias | AT5G37500_C1, CircGORK |
| Organism | Arabidpsis thaliana |
| Position | chr5: 14892940-14893314 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | AT5G37500 |
| Parent gene annotation |
gated outwardly-rectifying K+ channel |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT5G37500.3:2 AT5G37500.2:2 AT5G37500.1:2 AT5G37500.4:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.275256502 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14893297-14893221(-) |
| Potential amino acid sequence |
MFILVWAIYSSLFTPMEFGFFRGLPERLFVLDIVGQIAFLVDIVLQFFVAYRDTQTYRTVYKPT RIAFRYLKSHFLMDFIGCFPWDLIYKVVQGMGNVYIGVGNILLIVHSHGVWFLPRSA* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress (validated) |
| Other Information | |
|---|---|
| References | Zhang et al., 2019 |