Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G02500_circ_g.1 |
| ID in PlantcircBase | ath_circ_012571 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr2: 671180-671547 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT2G02500 |
| Parent gene annotation |
2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, chloro plastic |
| Parent gene strand | - |
| Alternative splicing | 2_circ_ag.3 |
| Support reads | 1 |
| Tissues | aerial |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT2G02500.2:3 AT2G02500.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.18267765 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
671494-671182(-) |
| Potential amino acid sequence |
MQTPQVIKPELLKKGFELVKSEGLEVTDDVSIVEYLKHPVYVSQGSYTNIKVNSDSLVVKTLDR KTLWEMQTPQVIKPELLKKGFELVKSEGLEVTDDVSIVEYLKHPVYVSQGSYTNIKVNSDSLVV KTLDRKTLWEMQTPQVIKPELLKKGFELVKSEGLEVTDDVSIVEYLKHPVYVSQGSYTNIKVNS DSLVVKTLDRKTLWEMQTPQVIKPELLKKGFELVKSEGLEVTDDVSIVEYLKHPVYVSQGSYTN IK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |