Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G02500_circ_g.1 |
ID in PlantcircBase | ath_circ_012571 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr2: 671180-671547 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT2G02500 |
Parent gene annotation |
2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, chloro plastic |
Parent gene strand | - |
Alternative splicing | 2_circ_ag.3 |
Support reads | 1 |
Tissues | aerial |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT2G02500.2:3 AT2G02500.1:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.18267765 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
671494-671182(-) |
Potential amino acid sequence |
MQTPQVIKPELLKKGFELVKSEGLEVTDDVSIVEYLKHPVYVSQGSYTNIKVNSDSLVVKTLDR KTLWEMQTPQVIKPELLKKGFELVKSEGLEVTDDVSIVEYLKHPVYVSQGSYTNIKVNSDSLVV KTLDRKTLWEMQTPQVIKPELLKKGFELVKSEGLEVTDDVSIVEYLKHPVYVSQGSYTNIKVNS DSLVVKTLDRKTLWEMQTPQVIKPELLKKGFELVKSEGLEVTDDVSIVEYLKHPVYVSQGSYTN IK(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |