Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d027320_circ_g.3 |
ID in PlantcircBase | zma_circ_006343 |
Alias | zma_circ_0000566 |
Organism | Zea mays |
Position | chr1: 2887462-2887845 JBrowse» |
Reference genome | AGPv4.38 |
Type | ei-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d027320 |
Parent gene annotation |
CemA-like proton extrusion protein-related |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d027321_T003:2 Zm00001d027321_T006:1 Zm00001d027321_T001:1 Zm00001d027321_T002:2 Zm00001d027321_T005:2 Zm00001d027321_T005:2 Zm00001d027321_T002:2 Zm00001d027321_T006:1 Zm00001d027321_T001:1 Zm00001d027320_T002:2 Zm00001d027321_T003:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.090663775 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2887509-2887554(-) 2887505-2887791(-) |
Potential amino acid sequence |
MYGPIWFMGLFYSCLSNDVRYVQKVPLAAELLDVRRSQKLQMVKDHAFLPSHMSCSVSKVCLLL RIHLLFFHQA*(-) MVRYGLWGCSIPAYLMMSGMSRRCRLQLSYLM*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |